Tap / click on image to see more RealViewsTM
£4.15
per badge
 

Glitch: achievement emblem skill unlock 3 cm round badge

Qty:
Round Badge
+£1.35
Small, 3.2 cm (1.25")
+£1.40
+£2.30
+£4.05
+£7.70

Other designs from this category

About badges

Sold by

Shape: Round Badge

With Zazzle badges buttons, you can do more than just express a political opinion. Since you can add your own designs, pictures, and text, you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 3.18 cm to 15.24 cm (1.25" to 6") diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in the U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age

About This Design

Glitch: achievement emblem skill unlock 3 cm round badge

Glitch: achievement emblem skill unlock 3 cm round badge

Glitch Square Template This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating8.8K Total Reviews
7911 total 5-star reviews657 total 4-star reviews140 total 3-star reviews61 total 2-star reviews78 total 1-star reviews
8,847 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By P.15 March 2022Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Really great template to create the badge - easy to use, clear and plenty of options. I chose to add my own artwork, and this was pretty easy to do and make adjustments, too. Good value I think too. Especially if ordering a large number. I initially have had one made, to see the quality of the product and speed of service. I will soon be ordering over 100, as the quality was excellent - colours, sharpness, positioning of artwork - all spot-on. And my order arrived pretty quickly as well! I initially had one badge made, to see the quality of the product and speed of service. I will soon be ordering over 100, as the quality was excellent - colours, sharpness, positioning of artwork - all spot-on.
5.0 out of 5 stars rating
5 out of 5 stars rating
By JoJo L.19 October 2019Verified Purchase
Round Badge, Small, 3.2 cm (1.25")
Zazzle Reviewer Program
I wanted a new badge for my collection and what better than this cute kitty! I’m a huge animal lover and especially cats so I couldn’t say no! Brilliant colour and clarity
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.19 August 2023Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Really nice quality badge. It’s great to wear in public so I don’t need to explain my tics. The badge is a great size and made very well. The pin works well. Nice printing and clear to read.

Tags

badges
achievementemblemskillunlockglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementemblemskillunlockglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 145995438251748225
Created on 12/10/2014, 9:45
Rating: G