Tap / click on image to see more RealViewsTM
£5.20
per card
 

Glitch: achievement epic urian

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.75
+£0.75
-£0.20

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Glitch: achievement epic urian

Glitch: achievement epic urian

Glitch: achievement epic urian This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.9 out of 5 stars rating7.6K Total Reviews
6913 total 5-star reviews518 total 4-star reviews75 total 3-star reviews30 total 2-star reviews45 total 1-star reviews
7,581 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Samantha D.4 September 2017Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Creator Review
The card was excellent this time preferred the quality of print etc. Brilliant clear and good quality pleasing to the eye
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sarah T.13 May 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Creator Review
Looked great and was perfect for my Nana's 99th it arrived super quick so much quicker than sending the original from the other side of the world! My Nan loved my artwork too and the picture of us inside helped her remember who I was as she has Alzheimer's. Crisp and clear. Bright and colorful true to the original artwork I created. The photo we placed inside also looked great and clear.
5.0 out of 5 stars rating
5 out of 5 stars rating
By MR M.1 April 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
This was used as a Mother's Day card and my mother absolutely loved it! The artwork and attention to detail is stunning. It's as if the hare could jump right out of the card at any moment. The print quality and colours are of a very high standard and show the beautiful hare in commendable detail.

Tags

Cards
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 137290151338997977
Created on 12/10/2014, 10:30
Rating: G