Tap / click on image to see more RealViewsTM
£39.35
per bag
 

Glitch: achievement epic urian large tote bag

Qty:
  1. Style

  2. Colour

Other designs from this category

About Bags

Sold by

Style: Jumbo Tote

Design your own tote bag to carry your belongings in style! Available in multiple sizes to suit all your carrying needs, these bags are made of 100% natural material and can be customised with your favourite pictures and text for the perfect gift or casual accessory. Versatile, trendy, and durable, this custom tote means you'll always look fashionable!

  • Dimensions: 36.8cm (L) x 50.8cm (W); 10.2cm deep
  • Material: 100% cotton
  • Squared bottom, perfect for groceries and larger items
  • Extra-long cotton web handles with stress-point reinforced stitching
  • Print on both sides for a small additional charge
  • Recommended care instructions: Hand wash cold. Do not bleach. Lay flat to dry. Do not iron.

About This Design

Glitch: achievement epic urian large tote bag

Glitch: achievement epic urian large tote bag

Glitch: achievement epic urian This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating6.9K Total Reviews
5268 total 5-star reviews1128 total 4-star reviews322 total 3-star reviews126 total 2-star reviews94 total 1-star reviews
6,938 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ruby2 November 2023Verified Purchase
Jumbo Tote
Zazzle Reviewer Program
The quality and functionality of this bag is so good! Really great! Looked classy and good quality
5.0 out of 5 stars rating
5 out of 5 stars rating
By Suzanne M.30 September 2021Verified Purchase
Budget Tote
Zazzle Reviewer Program
Blight for bridesmaids and mother of the bride, I bought the smaller size for my flower girl - they all loved them! The pattern went with our them perfectly and the girls loved them. The quality is fantastic, a really nice quality canvas bag. Great size for carrying their items to the wedding prep’. Perfect printing, no issues
5.0 out of 5 stars rating
5 out of 5 stars rating
By Square C.17 March 2023Verified Purchase
Jumbo Tote
Creator Review
Great quality, handy tote bag. The printing quality is excellent.

Tags

Bags
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 149160798136599712
Created on 12/10/2014, 10:30
Rating: G