Tap / click on image to see more RealViewsTM
£19.75
per tile
 

Glitch: achievement fine refiner blue class tile

Qty:
Small (4.25" x 4.25")
Frame and Keepsake Boxes available
Starting from £4.75
Select your accessory options after adding to cart

Other designs from this category

About Tiles

Sold by

Size: Small (4.25" x 4.25")

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home deco. This is a fully functioning tile and is great in backsplashes. Great for holiday, wedding, and office gifts.

  • Dimensions: 10.8 L x 10.8cm W; Thickness: 0.5cm
  • Weight: 106g.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 10.8 x 10.8cm. For best results please add 0.3cm bleed

About This Design

Glitch: achievement fine refiner blue class tile

Glitch: achievement fine refiner blue class tile

Glitch: achievement fine refiner blue class This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
965 total 5-star reviews63 total 4-star reviews19 total 3-star reviews10 total 2-star reviews9 total 1-star reviews
1,066 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Robert H.12 August 2020Verified Purchase
Ceramic Tile, Small (4.25" x 4.25")
Zazzle Reviewer Program
thank you so much , love this so glad i chose it , very pleased with how it looks brilliant, and very quick delivery. the printing was brilliant so clear and very bright , putting these as a feature in my bathroom , very pleased indeed thank you so much for your lovely work, ps do you do these in 12 inch as my friend would like that size , kind regards robert harris .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Barry C.4 October 2022Verified Purchase
Ceramic Tile, Large (6" x 6")
Zazzle Reviewer Program
Really nice image fixed to the tiles in my shower as a background to a soap dish. This was to hide the marks left by a broken soap dish. Just used tile adhesive and white grout. I think it looks good, almost like the drips are falling from the soap dish. No probs. Nice image.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lizzie B.16 October 2021Verified Purchase
Ceramic Tile, Large (6" x 6")
Zazzle Reviewer Program
My heart skipped a beat when I found this collection of Art Nouveau designs. I have created a fireplace where there was none. Amazing. The tiles were exactly as depicted

Tags

Tiles
achievementfinerefinerblueclassglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfinerefinerblueclassglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 227212541827224361
Created on 13/10/2014, 12:37
Rating: G