Tap / click on image to see more RealViewsTM
£35.85
per ornament
 

Glitch: achievement first mab emblem metal tree decoration

Qty:
  1. Style

Other designs from this category

About Ornaments

Sold by

Style: Premium Round Ornament

Capture wonderful family memories in a beautiful holiday keepsake with this premium round Christmas tree decoration. You can upload photos of your children, or your whole family, and send them out as holiday gifts.

  • Dimensions:
    • Diameter: 5.4 cm
    • Weight: 35.4 g.
  • Silver coloured metal tree decoration
  • Full-colour, full-bleed printing
  • UV Resistant and Waterproof
  • Creator Tip: To ensure the highest quality print, please note that this product's customisable design area measures 4.95 cm x 4.95 cm. For best results please add 0.15 cm (.12") bleed.

About This Design

Glitch: achievement first mab emblem metal tree decoration

Glitch: achievement first mab emblem metal tree decoration

Glitch: achievement first mab emblem This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating11.7K Total Reviews
9582 total 5-star reviews1293 total 4-star reviews380 total 3-star reviews175 total 2-star reviews288 total 1-star reviews
11,718 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jackie j.5 January 2020Verified Purchase
Premium Round Ornament
Zazzle Reviewer Program
Good quality lovely tree dec to enjoy for yrs to come. Quality item well made .printing very high standard
5.0 out of 5 stars rating
5 out of 5 stars rating
By A D.2 October 2017Verified Purchase
Premium Round Ornament
Zazzle Reviewer Program
Pleased with product, Strong, well made attractive. Crisp clean colours, true to Zazzle site
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nathan K.26 November 2018Verified Purchase
Premium Round Ornament
Zazzle Reviewer Program
This product is absolutely beautiful and stunning, It's the first I have used this site and the artist who made this have made my absolute day. I cannot compliment enough on how impressed I am. Thank you for such an amazing job. I think my friend is going to love this tomorrow when I give it to her. The printing is incredible, it's exactly what I was looking for my friend's favourite place is Nashville and now every time Christmas comes round she can look over at her tree and Nashville will be with her every Christmas. Again thank you so much for this incredible and beautiful product that you have produced for me. I will forever use this site now.

Tags

Ornaments
achievementfirstmabemblemglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfirstmabemblemglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 175399602482235531
Created on 13/10/2014, 12:51
Rating: G