Tap / click on image to see more RealViewsTM
£272.00
per watch
 

Glitch: achievement first zille emblem watch

Qty:
Stainless Steel Bracelet
-£136.00
-£136.00
-£136.00
-£136.00
-£41.00

About Watches

Sold by

Style: Men's Stainless Steel Bracelet Watch

The Men's Stainless Steel Watch is built for adventure. Designed as a nod to classic diver and military watches, it features stainless steel construction, an adjustable bezel, and water resistance to over 91.4 metres. Personalise the watch with your designs and text for a stylish memento that’s as rugged as you!

  • Men's wrist watch
  • Material:
    • Case: Stainless Steel
    • Strap: Stainless Steel
  • Dimensions:
    • Face: 3.1 cm diameter
    • Strap: 22.1 cm x 2.2 cm
    • Case: 4.2 cm diameter
    • Weight: 141.5 g
  • 3-hand analog Japan Quartz®
  • Full colour custom printing on face
  • Also available with a leather strap
  • Foldover clasp with trifold closure
  • Water Resistance: Up to 10 ATM (100 metres)
  • 1 year manufacturers limited warranty
  • Battery included
  • This product is recommended for ages 13+

About This Design

Glitch: achievement first zille emblem watch

Glitch: achievement first zille emblem watch

Glitch: achievement first zille emblem This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating1.4K Total Reviews
1092 total 5-star reviews154 total 4-star reviews33 total 3-star reviews23 total 2-star reviews70 total 1-star reviews
1,372 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tveit A.9 February 2016Verified Purchase
Watch, Stainless Steel Bracelet
Zazzle Reviewer Program
I bought a few of these watches and they both look great and work great. I can recommend them anytime. They combine my love for guitars and watches :-). Design turned out just as I hoped.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tveit A.9 February 2016Verified Purchase
Watch, Stainless Steel Bracelet
Zazzle Reviewer Program
I bought a few of these watches and they both look great and work great. I can recommend them anytime. They combine my love for guitars and watches :-). The design on this one also was just as I hoped it would be.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tveit A.9 February 2016Verified Purchase
Watch, Stainless Steel Bracelet
Zazzle Reviewer Program
I bought a few of these watches and they both look great and work great. I can recommend them anytime. They combine my love for guitars and watches :-). The design turned out just as I expected.

Tags

Watches
achievementfirstzilleemblemglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfirstzilleemblemglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256366708194949965
Created on 13/10/2014, 12:55
Rating: G