Tap / click on image to see more RealViewsTM
£44.25
per shirt
 

Glitch: achievement forgey laforge T-Shirt

Qty:
Basic T-Shirt
Black
Classic Printing: No Underbase
-£8.75
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating15.2K Total Reviews
10803 total 5-star reviews2931 total 4-star reviews842 total 3-star reviews395 total 2-star reviews259 total 1-star reviews
15,230 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tanya R.11 September 2022Verified Purchase
Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
When my teeshirt arrived I was delighted. The material is very good quality and it fitted me PERFECT. I think ZAZZLE is much better than other companies who sell teeshirts. I highly recommend anyone to shop here! THANKU ZAZZLE! 😀😁🙌. Printing on my teeshirt was perfect.
5 out of 5 stars rating
By Scriptural G.5 July 2020Verified Purchase
V-Neck T-Shirt, White, Adult S
Creator Review
I designed this shirt and I’m so happy with the print. I bought it in the cheaper shirt available and I bought it 2 sizes bigger because it runs small. It was perfect to wear to church today! It printed out beautifully! I’m so impressed with the quality!
5 out of 5 stars rating
By Pollyanna P.26 August 2019Verified Purchase
Basic T-Shirt, Black, Adult L
Zazzle Reviewer Program
I was so happy with how it came out and the personalisation, thank you so much! Such a great product!! Great! It was true to the online example and the quality was perfect :)

Tags

T-Shirts
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235881824069749665
Created on 13/10/2014, 13:05
Rating: G