Tap / click on image to see more RealViewsTM
£5.25
per magnet
 

Glitch: achievement good bubble farmer magnet

Qty:
Circle
+£0.95
Small, 3.2 Cm
+£0.95
+£1.75

Other designs from this category

About Magnets

Sold by

Shape: Circle

Give your fridge a personality upgrade. Upload a photo, design, or logo and turn it into a magnet that actually looks good up there.

  • Available in 3 sizes: 3.2 cm, 5.7 cm, and 7.6 cm diameter
  • USA-made with recycled domestic steel
  • Smooth glossy mylar finish, scratch and UV-resistant
  • Printed on FSC-certified recycled paper
  • Standard fridge-strength magnet
  • Also available in square or rectangle

About This Design

Glitch: achievement good bubble farmer magnet

Glitch: achievement good bubble farmer magnet

Glitch: achievement good bubble farmer This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating7.1K Total Reviews
6332 total 5-star reviews588 total 4-star reviews123 total 3-star reviews51 total 2-star reviews44 total 1-star reviews
7,138 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.22 August 2020Verified Purchase
Magnet, Style: Square, Size: 5.1 Cm
Zazzle Reviewer Program
Exactly as described. Good quality for reasonable price. Colour etc true to original picture. Very happy.
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.20 January 2019Verified Purchase
Magnet, Style: Square, Size: 5.1 Cm
Zazzle Reviewer Program
As with all fridge magnets I have purchased from Zazzle, this is a quality, well made item. Completely satisfied with the image quality; design, colours and printing of the words.
5.0 out of 5 stars rating
5 out of 5 stars rating
By MR C.22 August 2024Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
Good Quality Product, Good Size, Very Magnetic. Image Well Chosen. - Thanks. Printing very nice clear & sharp.

Tags

Magnets
achievementgoodbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementgoodbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 147376078649865790
Created on 21/10/2014, 18:28
Rating: G