Tap / click on image to see more RealViewsTM
£24.30
per specialty mug
 

Glitch: achievement harmony hound bone china mug

Qty:
Bone China
+£6.10
-£1.55

Other designs from this category

About Mugs

Sold by

Style: Bone China

Ready for your coffee, tea, soup, cider, or other tasty beverage, this fine porcelain mug complements both casual and formal table settings. It features a subtly fluted rim and an elegantly curved handle. Serves as a great housewarming gift!

  • Dimensions:
    • 295 ml: 7.1 cm D x 10.2 cm H
    • Microwave and dishwasher safe
    • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
    • Strong, ceramic construction
    • Meets FDA requirements for food and beverage safety
    • Do not overfill and be careful with hot liquids that may scald
    • Keep out of reach of children when filled with hot liquid
    Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.3 cm high x 18.4 cm wide
  • About This Design

    Glitch: achievement harmony hound bone china mug

    Glitch: achievement harmony hound bone china mug

    Glitch: achievement harmony hound This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.8 out of 5 stars rating1.2K Total Reviews
    1110 total 5-star reviews76 total 4-star reviews17 total 3-star reviews7 total 2-star reviews20 total 1-star reviews
    1,230 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Patricia B.9 December 2018Verified Purchase
    Bone China Mug
    Creator Review
    A lovely delicate but sturdy Tea Cup. Very impressed with the overall quality and design & I would highly recommend this product. The printing turned out better than I expected! The printing is clear & seamless and the colours are true to the original illustration. Very impressed and I would highly recommend.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Sarah C.12 January 2018Verified Purchase
    Jumbo Mug
    Zazzle Reviewer Program
    I love the gorgeous lettering on this and it's the perfect gift for the women in your life! The printing looked good, I like how the image was on both sides of the mug.
    from zazzle.com (US)
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By k.19 April 2014Verified Purchase
    Bone China Mug
    Zazzle Reviewer Program
    Good quality mug, it was the largest bone china mug that we could find that was customisable. So here is the plea make bigger bone china mugs. The user interface to upload images was really poor, but as I said the mug is excelent. Image could be a bit sharper, but it was not really noticeable unless you study the picture. I would definately buy again.

    Tags

    Mugs
    achievementharmonyhoundglitchglitchenwetdryvactinyspeckglitchthegame
    All Products
    achievementharmonyhoundglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 183489589679976770
    Created on 22/10/2014, 12:23
    Rating: G