Tap / click on image to see more RealViewsTM
£11.65
per keychain
 

Glitch: achievement hero cubimals key ring

Qty:
Aluminum Circle
+£3.05
+£3.05
+£14.90
+£14.90

Other designs from this category

About Keychains

Sold by

Style: Metal Circle Keychain

Keep your keys safe and spectacular with this sturdy aluminium keyring from Zazzle. Beautifully printed on both sides, you can choose from thousands of designs, or personalise it with your own photos, text or unique designs. Label your car keys or keep a family photo of loved ones close to you at all times, these personalised keyrings are light and waterproof.

  • Dimensions:
    • Diameter: 2"
    • Depth: 0.045"
    • Weight: 0.05 oz.
  • Full-colour, full-bleed printing
  • Silver coloured metal key ring with plastic snap ring
  • Light and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 2". For best results please add 1/16" bleed

About This Design

Glitch: achievement hero cubimals key ring

Glitch: achievement hero cubimals key ring

Glitch: achievement hero cubimals This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4334 total 5-star reviews813 total 4-star reviews226 total 3-star reviews121 total 2-star reviews108 total 1-star reviews
5,602 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lucy D.21 July 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
Perfect, exactly as the picture showed it would look, fell in love as soon as I saw It. Perfect printing, would order again
5.0 out of 5 stars rating
5 out of 5 stars rating
By Paula N.11 July 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
bought as birthday present for husband - Hawaiian theme, had to buy one for me also. exactly as advertised - perfect little gift
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 2"
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)

Tags

Keychains
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146528940696249206
Created on 22/10/2014, 12:39
Rating: G