Tap / click on image to see more RealViewsTM
£53.90
per clock
 

Glitch: achievement knight kingsguard round clock

Qty:
20.3 cm Round Acrylic
+£7.00
+£7.00
-£6.85
-£6.85
-£6.85

Other designs from this category

About Wall Clocks

Sold by

Style: 20.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 8" diameter or 10.75" diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

Glitch: achievement knight kingsguard round clock

Glitch: achievement knight kingsguard round clock

Glitch: achievement knight kingsguard This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating3.7K Total Reviews
3112 total 5-star reviews403 total 4-star reviews84 total 3-star reviews47 total 2-star reviews73 total 1-star reviews
3,719 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jane H.14 November 2017Verified Purchase
Wall Clock, 20.3 cm Round Acrylic
Creator Review
Absolutely loved this and so did my son. It was of a very good quality and now has pride of place in his bedroom. Highly recommended due to the superior finish. Top quality print and design.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michael O.28 August 2021Verified Purchase
Wall Clock, 20.3 cm Round Acrylic
Zazzle Reviewer Program
Nicely finished with a subtle hint of perfection. Ensures frequency to look at Our Lady Of Perpetual Help when checking the time. A nice to have ICON at home. Printing was nice and well finished
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.30 March 2021Verified Purchase
Wall Clock, 20.3 cm Round Acrylic
Zazzle Reviewer Program
Great quality clock and very well made. Just what I was looking for to finish my hall off. Looked in loads of other websites and eventually found exactly what I was looking for at Zazzle. Designe and colour is perfect. I just love it. Bought the medium size and fits well for where I was placing it.

Tags

Wall Clocks
achievementknightkingsguardglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementknightkingsguardglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256716540380696141
Created on 22/10/2014, 14:04
Rating: G