Tap / click on image to see more RealViewsTM
£33.40
per pet bowl
 

Glitch: achievement loyal tender bowl

Qty:
Medium Pet Bowl
+£4.60

About Pet Bowls

Sold by

Style: Medium Pet Bowl

Every pet needs a custom bowl from Zazzle! Printed with your favourite photos, text and designs, your pet will love our 100% ceramic bowls. Dishwasher and microwave approved, this medium bowl is as safe as it is easy to keep clean!

  • 6.4 cm (2.5") tall, 14.6 cm (5.75") diameter.
  • Dishwasher and microwave safe.
  • Printed in and shipped from the USA.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4.4 cm x 48.9 cm (1.75" x 19.25").

About This Design

Glitch: achievement loyal tender bowl

Glitch: achievement loyal tender bowl

Glitch: achievement loyal tender This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating414 Total Reviews
356 total 5-star reviews37 total 4-star reviews12 total 3-star reviews1 total 2-star reviews8 total 1-star reviews
414 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mary R.20 February 2019Verified Purchase
Large Pet Bowl
Zazzle Reviewer Program
Product is fantastic. Brilliant. However I think you need to have words with UPS as it is a miracle I received my order. They said I wasn't in even though I was in all day and they posted the failed delivery card through a letter box in a different street to where I live. If there hadn't been tracking I wouldn't even know it had arrived.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margaret S.26 November 2020Verified Purchase
Large Pet Bowl
Zazzle Reviewer Program
Love it and Samantha does too. Perfect, couldn’t be happier.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan M.16 December 2022Verified Purchase
Medium Pet Bowl
Zazzle Reviewer Program
This is a heavy, durable bowl decorated with Tibbies of many colors, the perfect size for hungry/thirsty Tibs. The design is interesting and printing clear.
from zazzle.com (US)

Tags

Pet Bowls
achievementloyaltenderglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementloyaltenderglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 215666190015603843
Created on 23/10/2014, 8:43
Rating: G