Tap / click on image to see more RealViewsTM
£24.30
per towel
 

Glitch: artefact nose of china tea towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Tea Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Glitch: artefact nose of china tea towel

Glitch: artefact nose of china tea towel

Glitch: artefact nose of china This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
1036 total 5-star reviews123 total 4-star reviews36 total 3-star reviews16 total 2-star reviews17 total 1-star reviews
1,228 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.23 May 2014Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
They absorb so well and wash up really nicely not losing their colour at all. They are expensive but in my opinion they are well worth the money. Yes they turned out perfectly to match my new kitchen
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pauline J.1 December 2022Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Really good quality, I like it a lot. Would recommend, a great gift idea.
5.0 out of 5 stars rating
5 out of 5 stars rating
By John C.9 June 2022Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Fantastic quality,and product arrived on time,excellent service well worth the money. 5/5. The colours could have been a bit brighter but overall the product was fine.3/5Print was good.

Tags

Kitchen Towels
artefactnosechinaglitchglitchenwetdryvactinyspeckglitchthegame
All Products
artefactnosechinaglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 197432002306092690
Created on 03/10/2014, 7:24
Rating: G