Tap / click on image to see more RealViewsTM
£16.70
per notebook
 

Glitch: compounds diabolic acid notebook

Qty:

Other designs from this category

About Notebooks

Sold by

Style: 16.51 cm x 22.22 cm (6.5" x 8.75") Classic Notebook

Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

  • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
  • Cover printed in vibrant, sharp colour
  • 80 black & white lined pages
  • College ruled
  • Lay flat spiral binding
This product is recommended for ages 8+..
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch: compounds diabolic acid notebook

Glitch: compounds diabolic acid notebook

Glitch: compounds diabolic acid This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.8K Total Reviews
1525 total 5-star reviews188 total 4-star reviews42 total 3-star reviews29 total 2-star reviews14 total 1-star reviews
1,798 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sandy M.23 March 2021Verified Purchase
16.51 cm x 22.22 cm (6.5" x 8.75") Classic Notebook
Zazzle Reviewer Program
My spiral notebook arrived today,looks even better when you actually see it.I was really wanting something different,and I have definitely got that,it is a certificate I got for donations I paid towards Duart Castle Restoration fund(Isle of Mull,Scotland). The printing is very clear and the colours spot on,i really love the quality of the print and notepad
5.0 out of 5 stars rating
5 out of 5 stars rating
By MARWA A.30 October 2021Verified Purchase
16.51 cm x 22.22 cm (6.5" x 8.75") Classic Notebook
Zazzle Reviewer Program
It’s absolutely amazing would highly recommend. Excellent printing really worth the price
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous7 January 2026Verified Purchase
16.51 cm x 22.22 cm (6.5" x 8.75") Classic Notebook
Lovely notepad. A bit flimsy and the binding wasn't done well. But made a lovely gift it being personalised. .

Tags

Notebooks
compoundsdiabolicacidglitchglitchenwetdryvactinyspeckglitchthegame
All Products
compoundsdiabolicacidglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 130823130589919417
Created on 03/10/2014, 8:42
Rating: G