Tap / click on image to see more RealViewsTM
Sale Price £28.95.  
Original Price £34.05 per shirt
You save 15%

Glitch Cthulhu Mask T-Shirt

Qty:
Kids Basic T-Shirt
+£13.45
+£3.50
Black
Classic Printing: No Underbase
-£7.60
-£4.55
-£7.60
-£4.55
-£4.55
-£4.55
-£4.55
-£4.55
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Kids' Basic T-Shirt

Wait 'till you get this tee on your kiddo, it'll take his everyday style to a whole new level--especially when you customise it with your own design.

Size & Fit

  • Model is 135 cm and is wearing a medium
  • Garment is unisex sizing
  • Standard fit
  • True to size

Fabric & Care

  • 6.0 oz.,/203 gsm, pre-shrunk 100% ComfortSoft® cotton; Oxford Green is 60/40
  • Shoulder-to-shoulder taping with coverstitched collar
  • Double-needle stitched armholes and sleeves
  • Imported
  • Machine wash cold

About This Design

Glitch Cthulhu Mask T-Shirt

Glitch Cthulhu Mask T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.7 out of 5 stars rating1.9K Total Reviews
1499 total 5-star reviews286 total 4-star reviews81 total 3-star reviews30 total 2-star reviews30 total 1-star reviews
1,926 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Annie B.29 May 2023Verified Purchase
Zazzle Reviewer Program
Good quality t-shirt, I didn't expect too much but it's good quality, matched the invites for my sons party and he absolutely loved opening this on his big day. Went straight to school with it, too! Print looks very good, vibrant colours, washing very well, too. I don't tumble dry tshirts so can't comment on that. Lovely idea for a birthday child!
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By N.15 March 2018Verified Purchase
Kids Basic T-Shirt, White, Youth XS
Zazzle Reviewer Program
T shirt is amazing, good material and nice printing They have good customer service as well. I definitely recommend this company. its a bit pricey compare to others but it worth it. is great, is better than I expected
5.0 out of 5 stars rating
5 out of 5 stars rating
By c.19 December 2014Verified Purchase
Kids Basic T-Shirt, Sapphire, Youth S
Zazzle Reviewer Program
strong soft cotton, lovely colour just a shade brighter than picture (better), good print, a bit of fun. image perfectly printed, no messy bits, very clean and clear.

Tags

T-Shirts
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 235052121719704683
Created on 23/11/2013, 17:27
Rating: G