Tap / click on image to see more RealViewsTM
£42.25
per tie
 

Glitch Cthulhu Mask Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm (55")
    • Width: 10.16 cm (4") (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small up-charge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Glitch Cthulhu Mask Tie

Glitch Cthulhu Mask Tie

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.5 out of 5 stars rating2.6K Total Reviews
1917 total 5-star reviews336 total 4-star reviews142 total 3-star reviews73 total 2-star reviews130 total 1-star reviews
2,598 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous5 August 2025Verified Purchase
Tie
Very happy with 1) quality of the print 2) quality & cut of the tie 3) speed of manufacturing 4) communication & 5) delivery to UK. I discovered the product just 2 weeks before a wedding so had to use the express delivery but it arrived within days so I could relax. My first experience of this seller & Zazzle and both were great .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mental M.29 March 2022Verified Purchase
Tie
Zazzle Reviewer Program
I wasn't sure what to expect but was excited to have a tie for my husband which matched my wedding attire. A super easy process taking a photo of my dress and uploading it to the website. I waited in anticipation not knowing how it would turn out. I couldn't believe the quality, its excellent. The print, pattern and colour is strong and vibrant. I have uploaded a photo but its difficult to see the tie against the dress because the quality is exceptional. I would have no hesitation using this company again.
5.0 out of 5 stars rating
5 out of 5 stars rating
By David P.8 January 2022Verified Purchase
Tie
Zazzle Reviewer Program
Very high quality tie,with bold colours,and high quality finish. Arrived on time,and is of excellent quality. Very clear,and bold colours

Tags

Ties
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 151799404367149809
Created on 23/11/2013, 17:27
Rating: G