Tap / click on image to see more RealViewsTM
£2.15
per postcard
 

Glitch dustbunny cubimal postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-£0.20

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H (5.6"x 4.25") qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Glitch dustbunny cubimal postcard

Glitch dustbunny cubimal postcard

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating16.3K Total Reviews
14861 total 5-star reviews1050 total 4-star reviews208 total 3-star reviews74 total 2-star reviews125 total 1-star reviews
16,318 Reviews
Reviews for similar products
5 out of 5 stars rating
By Patricia J.19 May 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Bought 10 Shakespeare quotes postcards and have framed them individually and placed them around the house Love them, some are funny and some are deep and meaningful! Lovely background on some, excellent printed words. A couple of plain white cards with black print - very stricking
5 out of 5 stars rating
By Ian T.27 March 2018Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
My order was probably an awkward one! I asked for a range of different fine-art prints, in postcard size. It was all freshly printed, delivered quickly and at a very reasonable price. Best quality matt finish I've seen on a fine-art print.
5 out of 5 stars rating
By Stephanie p.17 September 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
These cards are great quality, I use them as enclosure cards for my business! Hey are a little pricey but you definitely get the quality and professionalism! Repurchased a few times now and will continue to do so :). Beautiful, nice sheen on them, sharp and clear

Tags

Postcards
glitchglitchendustbunnydustbunnycubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchendustbunnydustbunnycubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 239446639547759723
Created on 23/11/2013, 17:38
Rating: G