Tap / click on image to see more RealViewsTM
£44.25
per shirt
 

Glitch emo bear cubimal T-Shirt

Qty:
Basic T-Shirt
Black
Classic Printing: No Underbase
-£8.75
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch emo bear cubimal T-Shirt

Glitch emo bear cubimal T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.6 out of 5 stars rating15.2K Total Reviews
10805 total 5-star reviews2931 total 4-star reviews842 total 3-star reviews394 total 2-star reviews259 total 1-star reviews
15,231 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tanya R.11 September 2022Verified Purchase
Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
When my teeshirt arrived I was delighted. The material is very good quality and it fitted me PERFECT. I think ZAZZLE is much better than other companies who sell teeshirts. I highly recommend anyone to shop here! THANKU ZAZZLE! 😀😁🙌. Printing on my teeshirt was perfect.
5 out of 5 stars rating
By Scriptural G.5 July 2020Verified Purchase
V-Neck T-Shirt, White, Adult S
Creator Review
I designed this shirt and I’m so happy with the print. I bought it in the cheaper shirt available and I bought it 2 sizes bigger because it runs small. It was perfect to wear to church today! It printed out beautifully! I’m so impressed with the quality!
5 out of 5 stars rating
By Pollyanna P.26 August 2019Verified Purchase
Basic T-Shirt, Black, Adult L
Zazzle Reviewer Program
I was so happy with how it came out and the personalisation, thank you so much! Such a great product!! Great! It was true to the online example and the quality was perfect :)

Tags

T-Shirts
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235217361453915941
Created on 23/11/2013, 17:39
Rating: G