Tap / click on image to see more RealViewsTM
£5.20
per card
 

Glitch gnome cubimal

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-£0.20
+£0.75
+£0.75

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (5" x 7") portrait or 17.8 cm x 12. 7 cm (7" x 5") landscape
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.6 cm x 10.2 cm (portrait) or 10.2 x 7.6 cm (landscape)
  • Standard white envelopes included

Paper Type: Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Glitch gnome cubimal

Glitch gnome cubimal

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating7.6K Total Reviews
6892 total 5-star reviews518 total 4-star reviews76 total 3-star reviews29 total 2-star reviews35 total 1-star reviews
7,550 Reviews
Reviews for similar products
4 out of 5 stars rating
By Samantha D.4 September 2017Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Creator Review
The card was excellent this time preferred the quality of print etc. Brilliant clear and good quality pleasing to the eye
5 out of 5 stars rating
By Sarah T.13 May 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Creator Review
Looked great and was perfect for my Nana's 99th it arrived super quick so much quicker than sending the original from the other side of the world! My Nan loved my artwork too and the picture of us inside helped her remember who I was as she has Alzheimer's. Crisp and clear. Bright and colorful true to the original artwork I created. The photo we placed inside also looked great and clear.
5 out of 5 stars rating
By MR M.1 April 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
This was used as a Mother's Day card and my mother absolutely loved it! The artwork and attention to detail is stunning. It's as if the hare could jump right out of the card at any moment. The print quality and colours are of a very high standard and show the beautiful hare in commendable detail.

Tags

Cards
glitchglitchengardengnomecubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchengardengnomecubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 137647836133156796
Created on 23/11/2013, 17:41
Rating: G