Tap / click on image to see more RealViewsTM
£30.40
per apron
 

Glitch: quest rook hall focusing orb standard apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W (24" x 28")
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch: quest rook hall focusing orb standard apron

Glitch: quest rook hall focusing orb standard apron

Glitch: quest rook hall focusing orb This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
1972 total 5-star reviews310 total 4-star reviews42 total 3-star reviews15 total 2-star reviews13 total 1-star reviews
2,352 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.17 March 2021Verified Purchase
Apron, Standard
Zazzle Reviewer Program
This is absolutely stunning, great quality & excellent value for money. I've had several customers compliment me on it! Branding looks amazing so crisp and clear
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.14 November 2017Verified Purchase
Apron, Standard
Zazzle Reviewer Program
This is a very good apron, well made, nice fabric - not too flimsy. Good colour and nice clear printing. Bought for son in law for birthday, he works on boats so anchor logo very fitting! He was very pleased with it. The printing is very good, colours nice and clear.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Apron G.29 July 2019Verified Purchase
Apron, Standard
Zazzle Reviewer Program
Really good quality product. It did arrive on time but the delivery is a long time. The printing quality is excellent.

Tags

Aprons
questrookhallfocusingorbglitchglitchenwetdryvactinyspeckglitchthegame
All Products
questrookhallfocusingorbglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154979659598286137
Created on 03/10/2014, 9:20
Rating: G