Tap / click on image to see more RealViewsTM
£11.65
per keychain
 

Glitch rook cubimal key ring

Qty:
Aluminum Circle
+£3.05
+£3.05
+£14.90
+£14.90

Other designs from this category

About Keychains

Sold by

Style: Metal Circle Keychain

Keep your keys safe and spectacular with this sturdy aluminium keyring from Zazzle. Beautifully printed on both sides, you can choose from thousands of designs, or personalise it with your own photos, text or unique designs. Label your car keys or keep a family photo of loved ones close to you at all times, these personalised keyrings are light and waterproof.

  • Dimensions:
    • Diameter: 2"
    • Depth: 0.045"
    • Weight: 0.05 oz.
  • Full-colour, full-bleed printing
  • Silver coloured metal key ring with plastic snap ring
  • Light and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 2". For best results please add 1/16" bleed

About This Design

Glitch rook cubimal key ring

Glitch rook cubimal key ring

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4342 total 5-star reviews814 total 4-star reviews226 total 3-star reviews121 total 2-star reviews109 total 1-star reviews
5,612 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lucy D.21 July 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
Perfect, exactly as the picture showed it would look, fell in love as soon as I saw It. Perfect printing, would order again
5.0 out of 5 stars rating
5 out of 5 stars rating
By Paula N.11 July 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
bought as birthday present for husband - Hawaiian theme, had to buy one for me also. exactly as advertised - perfect little gift
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 2"
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)

Tags

Keychains
rookcubimalglitchglitchenwetdryvactinyspeckglitchthegame
All Products
rookcubimalglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146027783891735129
Created on 23/11/2013, 17:45
Rating: G