Tap / click on image to see more RealViewsTM
£30.40
per apron
 

Glitch scion of purple cubimal standard apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W (24" x 28")
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch scion of purple cubimal standard apron

Glitch scion of purple cubimal standard apron

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
1974 total 5-star reviews310 total 4-star reviews42 total 3-star reviews15 total 2-star reviews13 total 1-star reviews
2,354 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.17 March 2021Verified Purchase
Apron, Standard
Zazzle Reviewer Program
This is absolutely stunning, great quality & excellent value for money. I've had several customers compliment me on it! Branding looks amazing so crisp and clear
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.14 November 2017Verified Purchase
Apron, Standard
Zazzle Reviewer Program
This is a very good apron, well made, nice fabric - not too flimsy. Good colour and nice clear printing. Bought for son in law for birthday, he works on boats so anchor logo very fitting! He was very pleased with it. The printing is very good, colours nice and clear.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Apron G.29 July 2019Verified Purchase
Apron, Standard
Zazzle Reviewer Program
Really good quality product. It did arrive on time but the delivery is a long time. The printing quality is excellent.

Tags

Aprons
scionpurplecubimalglitchglitchenwetdryvactinyspeckglitchthegame
All Products
scionpurplecubimalglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154390357675138028
Created on 23/11/2013, 17:46
Rating: G