Tap / click on image to see more RealViewsTM
£3.15
per sticker
 

Goat Stickers

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm (3") L x 8.89 cm (3.5") H
  • Design Area: 7.62 cm (3") L x 7.62 cm (3") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Goat Stickers

Goat Stickers

Great Design for Journals, Notebooks, School Projects etc..

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
906 total 5-star reviews65 total 4-star reviews27 total 3-star reviews22 total 2-star reviews78 total 1-star reviews
1,098 Reviews
Reviews for similar products
5 out of 5 stars rating
By Debra S.10 July 2024Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.
from zazzle.com (US)
5 out of 5 stars rating
By GINA A.27 July 2020Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker paper is sturdy, the colors are vibrant, and the adhesive is strong. Sticker is exactly what I wanted. Perfect for me to express both sides of my personality, cute and creepy, every day. Very satisfied with my purchase! The image is clear and cleans. The colors are vibrant.
from zazzle.com (US)
5 out of 5 stars rating
By r.28 April 2025Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy White
I bought a couple of glossy stickers, and they turned out great. The quality and design are on point.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
goatmilkcheesedairyanimalpetlivestockfarmhornspets
All Products
goatmilkcheesedairyanimalpetlivestockfarmhornspets

Other Info

Product ID: 256875953090371930
Created on 01/05/2023, 5:58
Rating: G