Tap / click on image to see more RealViewsTM
£29.55
per planner
 

God Speed Edmund Leighton Fine Art Mediaeval Planner

Qty:
Black

Other designs from this category

About Planners

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Planner

God Speed Edmund Leighton Fine Art Mediaeval Planner

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.7 out of 5 stars rating297 Total Reviews
256 total 5-star reviews24 total 4-star reviews3 total 3-star reviews3 total 2-star reviews11 total 1-star reviews
297 Reviews
Reviews for similar products
5 out of 5 stars rating
By Mey A.2 October 2022Verified Purchase
Standard (21.6 cm x 27.9 cm), Hard Cover, Gold Spiral Planner
Creator Review
The planner made it easier for me to arrange my schedule, there are enough pages for each month to add the dates yourself, and even some extra ones for short months. The quality is amazing! colors looked exactly as they did online, I even did another design similar to a friend of mine who loved it too !
5 out of 5 stars rating
By Hannah P.5 December 2020Verified Purchase
Standard (21.6 cm x 27.9 cm), Soft Cover, Gold Spiral Planner
Zazzle Reviewer Program
Turned out 100% better than I expected, amazing thank you! Perfect! Would defo recommended
5 out of 5 stars rating
By Mey A.2 October 2022Verified Purchase
Small (14 cm x 21.6 cm), Soft Cover, Gold Spiral Planner
Creator Review
originally designed this notebook a bit more blue, bigger and with a thick cover as my planner., My friend saw it and loved it and was asking if she could get one smaller, lighter in color and with a softcover, so I made this adaptation for her and she loves it !!! The colors came out so perfect, just as they looked in my computer!

Tags

Planners
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256869878912485903
Created on 13/01/2024, 0:00
Rating: G