Tap / click on image to see more RealViewsTM
£8.90
per set of 3 sheets
 

God Speed Edmund Leighton Fine Art Mediaeval Wrapping Paper Sheet

Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 48 cm x 73 cm

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customisable! Mix and match designs to create unique combinations
  • Dimensions: (3) 48 cm x 73 cm sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Wrapping Paper Sheet

God Speed Edmund Leighton Fine Art Mediaeval Wrapping Paper Sheet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
1029 total 5-star reviews50 total 4-star reviews16 total 3-star reviews4 total 2-star reviews23 total 1-star reviews
1,122 Reviews
Reviews for similar products
5 out of 5 stars rating
By Penny W.4 September 2021Verified Purchase
48 cm x 73 cm, Matte 48.3 cm x 73.7 cm
Zazzle Reviewer Program
Great quality paper could be used for any occasion and could be used for decoupage too. The printing quality is perfect .
5 out of 5 stars rating
By Jan T.16 February 2022Verified Purchase
Zazzle Reviewer Program
I have ordered several times from zazzle in the past. I particularly liked the colours on this one and I had the perfect piece waiting for it. So I painted an escritoire in a Farrow &Ball lime white which complimented the paper. I advertised it and within five minutes it was sold. Everyone commented on what a beautiful paper it was.It is very important in my furniture painting business to have a good quality products.I will definitely be ordering more in the future. Thank you. Great thanks . The colours were perfect
Original product
5 out of 5 stars rating
By Siân L.11 August 2023Verified Purchase
48 cm x 73 cm, Matte 48.3 cm x 73.7 cm
Zazzle Reviewer Program
I nearly cried opening this. I cannot believe how quick production and shipping was. Especially as I didn’t realise this was coming from the US to the UK! It’s absolutely amazing, oh I’m so pleased!!!! Amazing design. We have a bulldog and my fella has a Harley motorbike, so combining the two together is absolutely amazing. Thank you!!!!!

Tags

Wrapping Paper Sheet Sets
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256420946038786223
Created on 04/08/2023, 1:18
Rating: G