Sell on Zazzle
Tap / click on image to see more RealViewsTM
£7.05
per set of 6 labels
 

Green Watercolor Wedding Table Number Wine Label

4.9 out of 5 stars rating
597 Total Reviews |
by
Qty:
Style
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
-£1.15
-£2.35
+£4.75
+£4.75
+£4.75
+£4.75
+£4.75

Other designs from this category

About Food and Beverage Label Sets

Sold by
Food and Beverage Label Set
Create your own from scratch

Style: Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm (3.5"x4"); fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Green Watercolor Wedding Table Number Wine Label

Green Watercolor Wedding Table Number Wine Label

Make a statement at your wedding or event tables with our beautiful green watercolor table number wine labels. The design features a delicate watercolor motif in shades of green, adding a natural and elegant touch to your table setting. The labels are fully customisable. These table number labels are perfect to put on wine bottles, or any other beverage, as a way to indicate table numbers. These table number labels are printed on high-quality, waterproof and adhesive material, making it easy to stick and display on your bottles. Impress your guests with our stunning green watercolor table number wine labels at your special event.
Romantic Surprises
Artwork designed by
Cordoba, Córdoba, Argentina
View their Store

Customer Reviews

4.9 out of 5 stars rating597 Total Reviews
552 total 5-star reviews27 total 4-star reviews4 total 3-star reviews5 total 2-star reviews9 total 1-star reviews
597 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jessica W.9 November 2023 • Verified Purchase
Sparkling Wine Bottle Labels (10.2 cm x 8.9 cm)
Zazzle Reviewer Program
Gorgeous, can’t wait to use them for gifting alcohol at Christmas. Perfect, clean immaculate quality
5 out of 5 stars rating
By Lauren T.28 April 2023 • Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Absolutely fantastic quality print, even better than expected. Having these on wine bottles at the tables at my wedding for something unique. Amazing quality, very clear
5 out of 5 stars rating
By Wendy L.8 June 2020 • Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Fantastic surprise for my Partner! The labels are good quality and easy to apply. The colours are great and made our home made wine look really professional! So good we have re-ordered (just hope the wine lives up to the labels!)

Tags

Food and Beverage Label Sets
greenelegantbohocalligraphyweddingfancydarkclassicfairytale
All Products
greenelegantbohocalligraphyweddingfancydarkclassicfairytale

Other Info

Product ID: 256730755502215084
Created on 27/01/2023, 7:57
Rating: G