Tap / click on image to see more RealViewsTM
£2.70
per badge
 

Green Woman - Wood 3 Cm Round Badge

Qty:
Round Badge
+£0.85
Small, 3.2 cm (1.25")

Other designs from this category

About badges

Sold by

Shape: Round Badge

With Zazzle badges buttons, you can do more than just express a political opinion. Since you can add your own designs, pictures, and text, you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 3.18 cm to 15.24 cm (1.25" to 6") diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in the U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age

About This Design

Green Woman - Wood 3 Cm Round Badge

Green Woman - Wood 3 Cm Round Badge

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating8.7K Total Reviews
7784 total 5-star reviews647 total 4-star reviews137 total 3-star reviews58 total 2-star reviews69 total 1-star reviews
8,695 Reviews
Reviews for similar products
5 out of 5 stars rating
By P.15 March 2022Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Really great template to create the badge - easy to use, clear and plenty of options. I chose to add my own artwork, and this was pretty easy to do and make adjustments, too. Good value I think too. Especially if ordering a large number. I initially have had one made, to see the quality of the product and speed of service. I will soon be ordering over 100, as the quality was excellent - colours, sharpness, positioning of artwork - all spot-on. And my order arrived pretty quickly as well! I initially had one badge made, to see the quality of the product and speed of service. I will soon be ordering over 100, as the quality was excellent - colours, sharpness, positioning of artwork - all spot-on.
5 out of 5 stars rating
By JoJo L.19 October 2019Verified Purchase
Round Badge, Small, 3.2 cm (1.25")
Zazzle Reviewer Program
I wanted a new badge for my collection and what better than this cute kitty! I’m a huge animal lover and especially cats so I couldn’t say no! Brilliant colour and clarity
5 out of 5 stars rating
By S.19 August 2023Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Really nice quality badge. It’s great to wear in public so I don’t need to explain my tics. The badge is a great size and made very well. The pin works well. Nice printing and clear to read.

Tags

badges
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256305253868111648
Created on 23/04/2025, 9:56
Rating: G