Tap / click on image to see more RealViewsTM
£4.15
per bottle opener
 

Green Woman - Wood Bottle Opener

Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Bottle Opener

Sold by

Style: Bottle Opener

Make all your bottle openers fancy with Zazzle! Customise this magnet-backed bottle opener with your favourite images, designs, or text! Made to “stick" to any metal surface, this bottle opener looks great on your refrigerator, is perfect for parties, and makes an even better gift!

  • Dimensions: 5.7 cm diameter
  • Print area covered with scratch and UV-resistant Mylar
  • Opens standard beer and soft drink cap bottles
  • Made in U.S.A.

About This Design

Green Woman - Wood Bottle Opener

Green Woman - Wood Bottle Opener

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating163 Total Reviews
140 total 5-star reviews18 total 4-star reviews3 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
163 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jacqueline W.10 February 2024Verified Purchase
Bottle Opener
Creator Review
Purchased as a gift. I liked the size as it makes it very portable when on the move. I was impressed with the quality (both look and feel) of the bottle opener. The bottle opener arrived on time. The receiver was very happy with it. Great!!! Very impressed with the image.
5 out of 5 stars rating
By Nikki C.30 September 2021Verified Purchase
Zazzle Reviewer Program
Very cute and compact little bottle opener. Also very fond of the magnet, both for sticking to the fridge and holding on to the bottle cap when trying to open it. Good quality print. As pictured.
Original product
5 out of 5 stars rating
By A.13 July 2019Verified Purchase
Bottle Opener
Zazzle Reviewer Program
The quality of this bottle opener is fab. It's so neat and compact. Will fit in my handbag pocket if i want to take it with me anytime. The colours and details are great. I love how it actually turned out. I can definitely recommend to others.

Tags

Bottle Opener
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256250449226593531
Created on 23/04/2025, 10:30
Rating: G