Tap / click on image to see more RealViewsTM
£20.70
per keychain
 

Green Woman - Wood Key Ring

Qty:
Premium Round
-£13.55
-£14.10
-£13.55
Small (3.7 cm)

Other designs from this category

About Keychains

Sold by

Style: Premium Round Keychain

Keep your keys safe and spectacular with a round keyring from Zazzle. You can customise it with designs, photographs, or text. These keyrings are waterproof and have a UV coating that will protect any image or design you add.

  • Dimensions:
    • Diameter: 1.44" (3.66 cm)
    • Depth: 0.11" (0.28 cm)
    • Weight: 0.705 oz. (20 g)
  • Full-colour, full-bleed printing
  • Silver coloured metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 1.16" x 1.16" (2.95 cm x 2.95 cm). For best results please add 1/16" (0.16 cm) bleed

About This Design

Green Woman - Wood Key Ring

Green Woman - Wood Key Ring

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4322 total 5-star reviews811 total 4-star reviews223 total 3-star reviews119 total 2-star reviews103 total 1-star reviews
5,578 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jessica A.15 August 2019Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
I love it so much! I was worried when I saw the picture on the website, but when it was delivered I was blown away by how beautiful it looked! So beautifully done, it looks very professional!
5 out of 5 stars rating
By N.11 November 2021Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
Very well made and good quality 👌 Very Satisfied and Thank you Very much! Printing looks nice! I would recommend to anyone!
5 out of 5 stars rating
By Kenton W.15 September 2024Verified Purchase
Metal Circle Keychain, 2"
I Had To Buy Another One Of These Because The One Im Holding Was Not Red I Order Another One Please Make Sure It’s Red Like The Photo Described The 2nd Photo Is The One I Just Order.
from zazzle.com (US)

Tags

Keychains
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256756199699760004
Created on 23/04/2025, 10:01
Rating: G