Tap / click on image to see more RealViewsTM
£47.35
per clock
 

Green Woman - Wood Large Clock

Qty:
27.3 cm Acrylic
-£5.45
-£10.75
-£10.75
-£10.75

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.30 cm diameter (8" or 10.75")
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

Green Woman - Wood Large Clock

Green Woman - Wood Large Clock

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.7 out of 5 stars rating3.7K Total Reviews
3118 total 5-star reviews403 total 4-star reviews87 total 3-star reviews48 total 2-star reviews74 total 1-star reviews
3,730 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tammy j.9 September 2021Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
Absolutely loved it, bought for my nan & Bamp’s Emerald anniversary and they loved it. The writing on the clock was amazing
5.0 out of 5 stars rating
5 out of 5 stars rating
By Karen N.10 December 2017Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
Great style, perfect colouring & good quality. I absolutely love it. Definitely recommend it for those that have the marble/grey & rose gold colour schemes. Looks classy not tacky at all. the printing was perfect.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous13 January 2026Verified Purchase
Wall Clock, 27.3 cm Acrylic
Great clock looks good above my pool table .

Tags

Wall Clocks
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256686808927638609
Created on 23/04/2025, 10:32
Rating: G