Tap / click on image to see more RealViewsTM
£53.73
each
 

Green Woman - Wood Sherpa Blanket

Qty:
Personalise this template

Other designs from this category

About Sherpa Blankets

Sold by

Size: Medium

Cuddle up to warmth and comfort in our most luxurious blanket yet, the Sherpa fleece blanket. Perfect for those nights when your baby says "It's cold outside!"

  • Available in 3 different sizes: small 76.2 cm x 101.6 cm (30" x 40"); medium 127 cm x 152.4 cm (50" x 60"); large 152.4 cm x 203.2 cm (60" x 80")
  • Blanket features vividly customised image on one side and the softest Sherpa available on the reverse
  • Material: 100% polyester printed mink with ultra-soft sherpa backing
  • Sherpa side is non-customisable and the colour is off-white
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy hand sewn edge stitching for a clean finish
  • Machine wash separately with warm water, gentle cycle, mild detergent
  • Tumble dry low; do not iron or dry clean
  • Wash before first use
  • This product is recommended for ages 2+

About This Design

Green Woman - Wood Sherpa Blanket

Green Woman - Wood Sherpa Blanket

A Green Woman carved in wood with paint applied to the oak leaves and hair. Customise by adding your own text. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating354 Total Reviews
312 total 5-star reviews25 total 4-star reviews7 total 3-star reviews4 total 2-star reviews6 total 1-star reviews
354 Reviews
Reviews for similar products
5 out of 5 stars rating
By Bronagh F.15 October 2019Verified Purchase
Small
Zazzle Reviewer Program
The fabric is really soft, and thick, I’m sitting here with it wrapped around me and it’s so warm! It’s really smooth and sleek on the printed side and fluffy on the back. I love it! Such good quality, so vibrant and clear, not blurry at all! See the photos I’ve attached, there’s no filters or anything on them!
5 out of 5 stars rating
By M.21 April 2021Verified Purchase
Large
Zazzle Reviewer Program
Fantastic quality and the size is brilliant. Already looking at what other products are on the site as I will definitely be buying from here again. Absolutely fantastic. Some images came up with a warning as I was making the blanket but I didn’t have another copy so I went for it. I expected the photo to be really blurry but although not as clear as the others it is much clearer than I expected.
5 out of 5 stars rating
By Jess H.30 October 2023Verified Purchase
Small
Zazzle Reviewer Program
The feel was absolutely gorgeous! Unfortunately I underestimated the size but I have the large size in my basket waiting to go :). Fantastic quality! Really pleased with how the print came out

Tags

Sherpa Blankets
green womangreen manwild mancustomnature religionarchitecturemediaevalfertilitywiccaenvironment
All Products
green womangreen manwild mancustomnature religionarchitecturemediaevalfertilitywiccaenvironment

Other Info

Product ID: 256441961554307293
Created on 01/05/2025, 9:09
Rating: G