Tap / click on image to see more RealViewsTM
£7.05
per sheet of 20
 

Greenery Watercolor Foliage Save the Date Square Sticker

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Greenery Watercolor Foliage Save the Date Square Sticker

Greenery Watercolor Foliage Save the Date Square Sticker

Whimsical and charming Greenery Watercolor Foliage Save the Date Stickers with a painted watercolor look border of vibrant green leaves in a variety of shapes and sizes. These trendy and simple stickers are easy to customise with your wedding details. Find more personalisation options by clicking Customise.

Customer Reviews

4.8 out of 5 stars rating4.2K Total Reviews
3573 total 5-star reviews394 total 4-star reviews97 total 3-star reviews48 total 2-star reviews66 total 1-star reviews
4,178 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend
5 out of 5 stars rating
By Carolyn S.20 May 2018Verified Purchase
Zazzle Reviewer Program
These classy stickers sit well on products they look good, the ink, quality of paper & glue enhances the durability of the product . I would recommend these. The printing is high quality, the style is vintage which is the look I was going for

Tags

Stickers
weddingsave the datewatercolorgreeneryfoliagewhimsicaltrendysimpleleavesmodern
All Products
weddingsave the datewatercolorgreeneryfoliagewhimsicaltrendysimpleleavesmodern

Other Info

Product ID: 217457704309352961
Created on 02/03/2017, 16:55
Rating: G