Tap / click on image to see more RealViewsTM
Sale Price £31.02.  
Original Price £41.35 per shirt
You save 25%

Guardian Ancestor Hypatia, Women's T-Shirt

Qty:
Womens Basic T-Shirt
Black
Classic Printing: No Underbase
-£8.20
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.6 out of 5 stars rating15.2K Total Reviews
10788 total 5-star reviews2929 total 4-star reviews841 total 3-star reviews390 total 2-star reviews257 total 1-star reviews
15,205 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tanya R.11 September 2022Verified Purchase
Womens Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
When my teeshirt arrived I was delighted. The material is very good quality and it fitted me PERFECT. I think ZAZZLE is much better than other companies who sell teeshirts. I highly recommend anyone to shop here! THANKU ZAZZLE! 😀😁🙌. Printing on my teeshirt was perfect.
5 out of 5 stars rating
By David A.10 June 2023Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
Respecful to the design. Beautiful, as expected from Zazzle
5 out of 5 stars rating
By Scriptural G.5 July 2020Verified Purchase
Womens V-Neck T-Shirt, White, Adult S
Creator Review
I designed this shirt and I’m so happy with the print. I bought it in the cheaper shirt available and I bought it 2 sizes bigger because it runs small. It was perfect to wear to church today! It printed out beautifully! I’m so impressed with the quality!

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256365616848291214
Created on 28/03/2025, 4:19
Rating: G