Tap / click on image to see more RealViewsTM
£16.95
per window cling
 

Halloween Black Cat Window Cling

Qty:
12" x 12" (30.48cm x 30.48cm)
Opaque Design: All-over White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10cm x 10cm to a max of 132cm x 183cm (or max 183cm x 132cm if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Opaque Design: All-over White Underbase

The art is printed on a white sheet of plastic, which enhances the dynamic appearance of colors. Please note that the white sheet is opaque and will obscure text and art when viewed from the back of the window cling.

Adhesive: Cling art faces inward

The adhesive side is on the back of the window cling. All text and art are printed on the front of the window cling and face towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window where it has been applied.

About This Design

Halloween Black Cat Window Cling

Halloween Black Cat Window Cling

This awesome shaped window cling features a black cat with pointed ears, bright green eyes and a sly red grin. This creepy kitty is perfect for Halloween or for cat lovers.

Customer Reviews

3.6 out of 5 stars rating217 Total Reviews
125 total 5-star reviews11 total 4-star reviews7 total 3-star reviews13 total 2-star reviews61 total 1-star reviews
217 Reviews
Reviews for similar products
5 out of 5 stars rating
By mmmm A.29 August 2022Verified Purchase
Window Cling, Size: 8.00" x 11.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Zazzle Reviewer Program
It was really easy to order this window cling for my business. Just uploaded my logo, picked the size etc and it turned up really promptly. Super easy to fit and it looks great! Excellent price as well! I'll definitely be back for more for my car! Perfect printing! All the colours were spot on and they really pop!
5 out of 5 stars rating
By Mr R.7 December 2022Verified Purchase
Window Cling, Size: 20.00" x 30.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
Zazzle Reviewer Program
good quality product. good quality print
5 out of 5 stars rating
By In S.28 December 2024Verified Purchase
Window Cling, Size: 4.00" x 4.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Sharp detail print with bright colors. Looks good.

Tags

Window Clings
catshalloweenblackevilcreepykittyfamiliarvectorspetsanimals
All Products
catshalloweenblackevilcreepykittyfamiliarvectorspetsanimals

Other Info

Product ID: 256084747645379409
Created on 03/11/2021, 12:10
Rating: G