Tap / click on image to see more RealViewsTM
£18.40
per mug
 

Happy Bee Mug

Qty:
Combo Mug
-£1.85
-£0.90
+£2.70
+£2.30
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich colour. Match or complement the colour of your existing dinnerware set, or gift your friend a mug in his or her favourite colour.

  • 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating22.6K Total Reviews
19903 total 5-star reviews1898 total 4-star reviews360 total 3-star reviews159 total 2-star reviews253 total 1-star reviews
22,573 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.6 November 2021Verified Purchase
Combo Mug, 325 ml
Zazzle Reviewer Program
I loved designing this mug using images stored on Zazzle. Was able to choose the font for the name and uplaod a background for behind the name, and a fabulous image of a black and white horse. It came out beautifully well and I was well pleased.
3 out of 5 stars rating
By Anna K.24 November 2025Verified Purchase
Two-Tone Mug, 325 ml
Very good quality but photo is much darker than on the preview. The text is not visible very well. Unfortunately much darker than on preview .
5 out of 5 stars rating
By Nicky S.30 November 2020Verified Purchase
Combo Mug, 325 ml
Zazzle Reviewer Program
An attractive good quality item. The recipient is delighted with it, liked the humorous caption and has put it into use straight away. Very clear design and print with good colour quality.

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Created on 14/01/2009, 15:41
Rating: G