Sell on Zazzle
Tap / click on image to see more RealViewsTM
£13.95
per mug
 

HAPPY NEW YEAR 2025 COFFEE MUG

4.8 out of 5 stars rating
22507 Total Reviews |
by
Qty:
Style
Classic Mug
+£0.80
+£1.55
+£3.80
+£3.50
Size

Other designs from this category

About Mugs

Sold by
Mug
Create your own from scratch

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

HAPPY NEW YEAR 2025 COFFEE MUG

HAPPY NEW YEAR 2025 COFFEE MUG

Celebrate the start of 2025 with every sip using this festive 'HAPPY NEW YEAR 2025' mug! Perfect for enjoying a hot drink on New Year's Day or gifting to loved ones as a memorable keepsake, this high-quality mug adds a touch of celebration to your daily routine. Great for coffee, tea, or cocoa, it's the ideal companion for New Year’s resolutions or reflecting on the past year. Start each morning with a fresh outlook and a little extra cheer! Keywords: New Year’s 2025 mug, holiday gift, celebration mug, New Year’s Day coffee cup, 2025 drinkware
Store
Artwork designed by
Essaouira, Marrakech-Safi, Morocco
View their Store

Customer Reviews

4.8 out of 5 stars rating22.5K Total Reviews
19856 total 5-star reviews1896 total 4-star reviews358 total 3-star reviews153 total 2-star reviews244 total 1-star reviews
22,507 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016 • Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020 • Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020 • Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
happynewyear2025newyearmug2025celebrationholidaygiftnewyearskeepsakenewyearscoffeecelebrate2025festivedrinkwarenewyeargiftideasringin2025
All Products
happynewyear2025newyearmug2025celebrationholidaygiftnewyearskeepsakenewyearscoffeecelebrate2025festivedrinkwarenewyeargiftideasringin2025

Other Info

Product ID: 256855942039488807
Created on 13/11/2024, 13:25
Rating: G