Tap / click on image to see more RealViewsTM
£25.05
per pillowcase
 

Hummingbird Bird Flower Floral Creation Pillowcase

Qty:
Standard
Single Pillowcase

Other designs from this category

About Pillowcases

Sold by

Set Size: Single Standard Size Pillowcase

Doze off in serious style with a one-of-a-kind pillowcase. Create a luxourious getaway with this super soft and cozy pillowcase. Counting sheep has never been easier, and sleep never ever felt soooo good.

  • Standard pillowcase dimensions: 20"h x 30"w
  • Made from 100% soft microfibre polyester
  • High quality sublimation printing allows for vibrant colour
  • Double-sided printing available for additional upcharge
  • Pillowcase is printed before being sewn, allowing for beautiful edge-to-edge printing
  • Machine wash/dry
  • Pillow not included
  • Made and shipped from the USA

About This Design

Hummingbird Bird Flower Floral Creation Pillowcase

Hummingbird Bird Flower Floral Creation Pillowcase

Gorgeous collage of botanical fine art of Hummingbird Birds and Flowers by Gould is on this All Creation Sings His Praises Pillowcase. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.9 out of 5 stars rating218 Total Reviews
205 total 5-star reviews9 total 4-star reviews2 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
218 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.15 January 2024Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
I'd really recommend this pillow case. I have black duvet covers and wanted to add some colour. These do the trick perfectly, The colours are really vibrant and I was impressed with the quality of the fabric. Print quality is excellent, 5 stars!
5 out of 5 stars rating
By Toni B.17 January 2018Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
Quality is lovely, My Husband is in Hospital a lot and thought this would be nice to have with him. Print was at a high standard
5 out of 5 stars rating
By Greg R.19 February 2020Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
My girlfriend nearly cried when she opened the package. Very custom and from the heart. I will order more. The printing is beautiful! And the pillowcase fabric is high quality. Very impressive.
from zazzle.com (US)

Tags

Pillowcases
flowersfloralhummingbirdbirdwildlifeanimalsvintagepraisesgodcreation
All Products
flowersfloralhummingbirdbirdwildlifeanimalsvintagepraisesgodcreation

Other Info

Product ID: 256209242988998924
Created on 26/07/2015, 6:26
Rating: G