Sell on Zazzle
Tap / click on image to see more RealViewsTM
£3.40
per sticker
 

Kawaii Alien Cat with Galactic Eyes and Pastel Out

4.5 out of 5 stars rating
1120 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Kawaii Alien Cat with Galactic Eyes and Pastel Out

Kawaii Alien Cat with Galactic Eyes and Pastel Out

This kawaii alien cat design combines cosmic charm with a playful twist. Featuring a chibi-style alien kitty with mesmerising galactic eyes and a pastel-striped outfit, this design is both whimsical and adorable. Perfect for fans of space-themed art and unique animal characters, this alien cat radiates a magical extraterrestrial vibe. The colourful gradient tones and sparkling details make it an ideal choice for stickers, apparel, and home decor. Whether you're an animal lover, a space enthusiast, or just enjoy cute and quirky designs, this kawaii alien cat is a fun and vibrant addition to your collection or a perfect gift for someone who loves cosmic creations.
Qwiimi Studio
Artwork designed by
Hong Kong, HK, Hong Kong
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
917 total 5-star reviews65 total 4-star reviews27 total 3-star reviews27 total 2-star reviews84 total 1-star reviews
1,120 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kevin L.29 March 2021 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
These stickers look and feel fantastic. The material is in a matte finish, and is the biggest size print (Extra-Large 35.6 x 35.6 cm). I love the bright colours. I’m super happy with all the prints had come out. It gives us great confidence of the products. The colours are bright and colourful and don’t run (something I was really worried about), and the look of them feels great.
5 out of 5 stars rating
By Rebecca B.27 February 2024 • Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Printing was great very clear and great quality
5 out of 5 stars rating
By Rebecca B.27 February 2024 • Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Excellent quality and Very clear printing Love how some of the verse was separate really happy

Tags

Custom-Cut Vinyl Stickers
kawaiialiencutecatillustrationvibrantkittypastelwhimsicalanimal
All Products
kawaiialiencutecatillustrationvibrantkittypastelwhimsicalanimal

Other Info

Product ID: 256867447782958036
Created on 23/01/2025, 8:49
Rating: G