Sell on Zazzle
Tap / click on image to see more RealViewsTM
£9.10
per sheet of 20
 

Kawaii Easter bunny owl and dinosaur stickers

4.8 out of 5 stars rating
27355 Total Reviews |
by
Qty:
Shape
Square Stickers
+£0.30
+£0.30
+£0.30
Size
Paper Type

Other designs from this category

About Stickers

Sold by
StickerCreate your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Kawaii Easter bunny owl and dinosaur stickers

Kawaii Easter bunny owl and dinosaur stickers

Not a touch of springtime to envelopes gifts and notebooks with these adorable stickers featuring a charming little owl and a friendly dinosaur dressed in fuzzy bunny ears. This happy Easter design is blooming with pastel flowers and colourful eggs. These high-quality vibrant stickers are perfect for ceiling Easter cards, decorating party favours or adding some Kawaii prehistoric fun to your everyday items.tags: on tag Easter
Rangergeek
Artwork designed by
notts area, United Kingdom
View their Store

Customer Reviews

4.8 out of 5 stars rating27.4K Total Reviews
23667 total 5-star reviews2234 total 4-star reviews572 total 3-star reviews351 total 2-star reviews531 total 1-star reviews
27,355 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025 • Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020 • Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017 • Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
bunnypastelwhimsicalkidstackenvelopekids easter stickersfun stickers kidsrex hoot stickerskids adults easter stickers
All Products
bunnypastelwhimsicalkidstackenvelopekids easter stickersfun stickers kidsrex hoot stickerskids adults easter stickers

Other Info

Product ID: 256231297785162877
Created on 31/03/2026, 2:59
Rating: G