Tap / click on image to see more RealViewsTM
£18.35
per mug
 

Keep Calm And Call Chief Warrant Officer Corps Eag Coffee Mug

Qty:
Classic Mug
+£1.50
+£3.05
+£7.65
+£15.30

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Keep Calm And Call Chief Warrant Officer Corps Eag Coffee Mug

Keep Calm And Call Chief Warrant Officer Corps Eag Coffee Mug

A majestic eagle rises from the Chief Warrant Officer Corps insignia, a reminder to stay calm and call on the expertise of the Corps in times of need.

Customer Reviews

4.8 out of 5 stars rating22.5K Total Reviews
19823 total 5-star reviews1895 total 4-star reviews358 total 3-star reviews150 total 2-star reviews242 total 1-star reviews
22,468 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
keepcalmcallchiefwarrantofficercorpseaglerisingmilitaryarmynavyairforcemarinesusmilitary
All Products
keepcalmcallchiefwarrantofficercorpseaglerisingmilitaryarmynavyairforcemarinesusmilitary

Other Info

Product ID: 256879050985628154
Created on 23/02/2024, 18:26
Rating: G