Tap / click on image to see more RealViewsTM
£20.00
per towel
 

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Tea Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Cool collage of vintage botanical fine art of Kingfisher Alcedo Birds and Cattails at a pond is on this Kitchen Towel. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
1032 total 5-star reviews122 total 4-star reviews37 total 3-star reviews15 total 2-star reviews17 total 1-star reviews
1,223 Reviews
Reviews for similar products
5 out of 5 stars rating
By Shirley H.6 September 2024Verified Purchase
Kitchen Towel
Creator Review
I was delighted with the beautiful tea towels, the design looked really lovely. I adore garden ponds and these towels and other products I ordered with the same design will bring me so much pleasure. My garden is too small for a real pond. If you love ponds and wildlife this design is for you!
5 out of 5 stars rating
By Pauline J.1 December 2022Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Really good quality, I like it a lot. Would recommend, a great gift idea.
5 out of 5 stars rating
By C.23 May 2014Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
They absorb so well and wash up really nicely not losing their colour at all. They are expensive but in my opinion they are well worth the money. Yes they turned out perfectly to match my new kitchen

Tags

Kitchen Towels
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds
All Products
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds

Other Info

Product ID: 197316344225007716
Created on 14/07/2019, 7:23
Rating: G