Sell on Zazzle
Tap / click on image to see more RealViewsTM
£10.00
per sheet of 20
 

Knight Dog Cartoon Design Square Sticker

4.8 out of 5 stars rating
27279 Total Reviews |
by
Qty:
Shape
Square Stickers
+£0.35
+£0.35
+£0.35
Size
Paper Type

Other designs from this category

About Stickers

Sold by
Sticker
Create your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Knight Dog Cartoon Design Square Sticker

Knight Dog Cartoon Design Square Sticker

Knight Dog Cartoon design features an illustration of a cool dog warrior with armour and sword. Perfect gift for boy and girl, man and woman that loves knight dog, fantasy mediaeval dog, dog king, retro animals, cute dogs, dog berserk, funny movie with pet heroes, dog with shield and sword, armour doggo, cartooned cinema dog, comedian puppy, vintage dog art, funny historic dog pic, retro style dog portrait.
HAPPY GIFTS
Pro
Artwork designed by
Korea, Republic of
View their Store

Customer Reviews

4.8 out of 5 stars rating27.3K Total Reviews
23610 total 5-star reviews2230 total 4-star reviews567 total 3-star reviews350 total 2-star reviews522 total 1-star reviews
27,279 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025 • Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020 • Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017 • Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
knightdogfantasymediaevalanimekingretro90sberserkcastle
All Products
knightdogfantasymediaevalanimekingretro90sberserkcastle

Other Info

Product ID: 217720917384349379
Created on 04/07/2020, 17:06
Rating: G