Tap / click on image to see more RealViewsTM
£13.40
per mug
 

Lantern Floating Festival Coffee Mug

Qty:
Classic Mug
+£1.10
+£2.20
+£5.55
+£11.15

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Lantern Floating Festival Coffee Mug

Lantern Floating Festival Coffee Mug

This art piece illustrates the Lantern Festival, as it takes place in Hawai'i. The Lantern Festival has its origins in Buddhist ceremonies to honour the deceased. In Japan, the practice came to be associated with the end of Obon, a celebration of ancestors. Once the practice came to Hawai'i, it came to be celebrated on Memorial Day, tying in with the holiday traditions of honouring men and women who died in the armed forces, and is celebrated by people of all backgrounds. The practice is environmentally friendly – all lanterns are gathered after the ceremony and reused.

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19636 total 5-star reviews1890 total 4-star reviews344 total 3-star reviews140 total 2-star reviews219 total 1-star reviews
22,229 Reviews
5 out of 5 stars rating
By Suzanne S.23 December 2012Verified Purchase
Classic Mug, 325 ml
Creator Review
I was extremely impressed with how beautiful the mug turned out to be – the quality was even better than I expected. See my full review with photos on my website: http://wp.me/p2SXXj-4B. The photo was rendered in exquisite high resolution, and was set off nicely by the shimmer of the high gloss finish. The shimmer makes the lanterns in my design glow even more.
from zazzle.com (US)
4 out of 5 stars rating
By Suzanne S.23 December 2012Verified Purchase
Classic Mug, 325 ml
Creator Review
The lid fits snugly and doesn’t leak around the edges, however if turned upside down water can leak out through the mouth hole even when twisted closed. See my full review with photos on my website: http://wp.me/p2SXXj-4B. I opted for the stainless silver style. Although not all designs work well on the silver, the design I chose was well suited to it. The travel mugs also have an elegant shimmer, which makes the lanterns in my design glow even more.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!

Tags

Mugs
lantern festivalancestorsbuddhismhawaiiremembrancememorial dayfamilydeceasedveteransspirits
All Products
lantern festivalancestorsbuddhismhawaiiremembrancememorial dayfamilydeceasedveteransspirits

Other Info

Product ID: 168176685301395306
Created on 01/11/2012, 6:38
Rating: G