Tap / click on image to see more RealViewsTM
£11.45
per sticker
 

Let's go Sticker Car

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 35.56 cm (14") L x 36.83 cm (14.5") H
  • Design Area: 35.56 cm (14") L x 35.56 cm (14") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Let's go Sticker Car

Let's go Sticker Car

Ignite your adventures with our vibrant "Let’s Go" sticker! Designed to inspire spontaneity and a love for the open road, this eye-catching sticker features bold, dynamic typography that captures the thrill of exploration. Stick it on your bumper, window, or wherever you want to spread the spirit of adventure. Let the world know you’re ready to hit the road and embrace every journey that comes your way!

Customer Reviews

4.6 out of 5 stars rating45 Total Reviews
39 total 5-star reviews1 total 4-star reviews1 total 3-star reviews1 total 2-star reviews3 total 1-star reviews
45 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.19 December 2022Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Great quality car stickers and our logo image was beautifully printed. Very happy with the product. Logo to print was sharp / clear
5 out of 5 stars rating
By Avril O.6 January 2020Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
I love the cut-out shape of this sticker. I can put this schoolgirl on my stationery that I already have. All the colours reproduced perfectly- the delicate roses and the fine details oy eyes and tie are all there.
5 out of 5 stars rating
By Vicki P.28 October 2022Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Good quality sticker, sticks well to the car window. Good quality printing, exactly as order preview

Tags

Custom-Cut Vinyl Stickers
letsgostickeradventurestickertravelstickerroadtripstickerbumperstickervinylcarstickercaraccessoriestravelessentialsmotivationalstickercustomsticker
All Products
letsgostickeradventurestickertravelstickerroadtripstickerbumperstickervinylcarstickercaraccessoriestravelessentialsmotivationalstickercustomsticker

Other Info

Product ID: 256880978172582416
Created on 09/10/2024, 1:12
Rating: G