Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Sale Price £5.44.  
Original Price £6.80 per sheet of 6
You save 20%

Loving Cat Illustration Happy Birthday Girl Party Square Sticker

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Loving Cat Illustration Happy Birthday Girl Party Square Sticker

Loving Cat Illustration Happy Birthday Girl Party Square Sticker

A lovely cat surrounded by delicate flowers. The purr-fect (perfect) pawty! Simulated gold glitter.

Customer Reviews

4.8 out of 5 stars rating27K Total Reviews
23409 total 5-star reviews2220 total 4-star reviews542 total 3-star reviews317 total 2-star reviews476 total 1-star reviews
26,964 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
gold glittergorgeousgraciousbeautifulfloralprettycharmmagnificentpinkkids celebration
All Products
gold glittergorgeousgraciousbeautifulfloralprettycharmmagnificentpinkkids celebration

Other Info

Product ID: 217741625989201497
Created on 24/09/2022, 11:01
Rating: G