Tap / click on image to see more RealViewsTM
Sale Price £2.41.  
Original Price £3.21 per card
You save 25%

Loving Words Valentine's Day Greeting Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.59
-£0.16

Other designs from this category

About Folded Holiday Cards

Sold by

Size: 12,7 × 17,8 cm

Wishing everyone a season of gladness, a season of cheer and to top it all off, a wonderful year. Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm x 17.8 cm (portrait); 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Loving Words Valentine's Day Greeting Card

Loving Words Valentine's Day Greeting Card

a unique approach to valentine's day cards...© 2004-2014 MarloDee Designs :: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.9 out of 5 stars rating7.3K Total Reviews
6753 total 5-star reviews372 total 4-star reviews75 total 3-star reviews37 total 2-star reviews67 total 1-star reviews
7,304 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.10 May 2021Verified Purchase
Folded Holiday Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte
Zazzle Reviewer Program
The card was just as I thought if not better! The quality was fantastic & the recipient was delighted also! The colours were even brighter than I imagined & the semi gloss was really affective.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Isla M.8 March 2021Verified Purchase
Folded Holiday Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte
Zazzle Reviewer Program
Used as a valentines card. Was perfect for being not too slushy but till saying 'I still love u even after all this time!!'. Simple black a white is perfect for this card.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gillian B.12 March 2022Verified Purchase
Folded Holiday Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte
Zazzle Reviewer Program
Absolutely loved this card which was for husband on valentines day from our little yorkie. The yorkie on the card looked just like ours and because I could change the words to what I wanted was Absolutely Brilliant. Everything was exactly as I wanted the little yorkie was brilliant just like ours.

Tags

Folded Holiday Cards
valentinesdaylovesweetestweddingpinkchicstylishunique
All Products
valentinesdaylovesweetestweddingpinkchicstylishunique

Other Info

Product ID: 137642364302511547
Created on 19/01/2014, 15:27
Rating: G