Tap / click on image to see more RealViewsTM
£48.70
per wallpaper
 

Magical Unicorn Wallpaper

Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish embossed with a canvas texture and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colours to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Magical Unicorn Wallpaper

Magical Unicorn Wallpaper

Looking for the perfect touch to transform your little girl's room into a dreamlike kingdom? This is the secret to a joyful moment that will light up her face with an unforgettable smile! Our unique wallpaper, with its playful unicorn design, warm hearts, and soft clouds, adds unparalleled depth and charm. It's not just decoration; it's the perfect backdrop for your most precious moments: quiet reading, joyful play, and cozy cuddles. Make her main wall shine and capture everyone's attention. • Enchanting design: Creates a vibrant and imaginative atmosphere. • Exceptional quality: Ensures easy installation and long-lasting durability. Invest in the beauty and happiness of her space today and let her room reflect her unique personality!

Customer Reviews

4.1 out of 5 stars rating7 Total Reviews
5 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
7 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tiffany A.27 March 2026Verified Purchase
Custom Wallpaper 2' x 4' (0.61mx 1.22m), Textured vinyl
Better than anticipated. Just the right pattern and with an installer from Thumbtack, looks beyond seamless. A dreamy pattern I will forever be grateful for. .
from zazzle.com (US)
5 out of 5 stars rating
By Charles K.15 August 2025Verified Purchase
Custom Wallpaper 2' x 4' (0.61mx 1.22m), Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
from zazzle.com (US)
5 out of 5 stars rating
By Suzanne R.18 September 2025Verified Purchase
Custom Wallpaper 2' x 4' (0.61mx 1.22m), Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
from zazzle.com (US)

Tags

Wallpapers
unicorn wallpaper kidspurple unicorn patterngirls bedroom decorclouds hearts starskawaii cute nurserymagicalwhimsicaldreamypinkyellow
All Products
unicorn wallpaper kidspurple unicorn patterngirls bedroom decorclouds hearts starskawaii cute nurserymagicalwhimsicaldreamypinkyellow

Other Info

Product ID: 256122755732034014
Created on 12/11/2025, 2:36
Rating: G