Tap / click on image to see more RealViewsTM
£14.70
per mug
 

Matanuska Moose Milk Coffee Mug

Qty:
Classic Mug
+£0.80
+£1.60
+£4.00
+£3.65

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Matanuska Moose Milk Coffee Mug

Matanuska Moose Milk Coffee Mug

The company logo of world famous and entirely mythical Matanuska Moose Milk dairy farm in Willow Alaska, not too far from Anchorage.The image features a milkmaid hand milking Matilda, the farm's first dairy moose. Add your own text on the reverse side. You may change the background colour. Believe it or not there are moose dairies; a small number in Russia and one in Sweden. Moose milk is commercially farmed in Russia. A farm-born moose calf is taken from its mother within 2–3 hours after birth and is raised by people. It is first bottle-fed with a milk substitute, and later fed from a bucket. The animals imprint and become attached to humans. The milk is high in butterfat (10%) and solids (21.5%), according to data collected on Russian moose; research into American moose milk is in a less advanced state than in Russia, but appears to indicate that American moose have even higher concentrations of solids in their milk. Moose milk is said to be a bit salty and bitter; with a hint of pine or spruce needles. Moose milk is commercially farmed in Russia. A farm-born moose calf is taken from its mother within 2–3 hours after birth and is raised by people. It is first bottle-fed with a milk substitute, and later fed from a bucket. The animals imprint and become attached to humans. As with dairy cattle, calves are removed from their mothers after a short time.The Russians say moose soon recognise the milkmaids as their substitute as her substitute calves. At this point they are released to the forest; but visit the farm every day to be milked during the lactation period (typically, until September or October). During winter the animals roam free throughout the surrounding forest. But they usually do not stray too far, but spend much of their time at nearby woodlots where trees are being cut, feeding on the byproducts of timber operations. And they know the farm as the place for a daily rations of oatmeal, and as a safe place to give birth to their young. One Russian sanitorium serves moose milk to residents in the belief that it helps them recover from disease or manage chronic illness more effectively. Some Russian researchers have recommended that moose milk could be used for the prevention of gastroenterological diseases in children. The Elk (Moose are called Elk in Europe) House (Älgens Hus) farm in Bjurholm, Sweden is believed to be the world's only producer of moose cheese. The cheese sells for about 500 dollars per pound. Algens Hus' restaurant offers moose-cheese dishes. Cheese plain with bread or biscuits, or better yet, frozen moose mousse. Best served with raspberries.

Customer Reviews

4.8 out of 5 stars rating22.6K Total Reviews
19910 total 5-star reviews1899 total 4-star reviews360 total 3-star reviews159 total 2-star reviews251 total 1-star reviews
22,579 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
moosefarminghumourfunnyanimalswildlifealaskamilkdairysweden
All Products
moosefarminghumourfunnyanimalswildlifealaskamilkdairysweden

Other Info

Product ID: 168245202485790312
Created on 20/06/2016, 10:56
Rating: G