Tap / click on image to see more RealViewsTM
Sale Price £32.08.  
Original Price £40.10 per poster
You save 20%

Medieval Chainmail Patent Blueprint Poster

Qty:
  1. Size: 60.96 cm x 81.28 cm (24"x32")

    Find your size.
  2. Paper Type

  3. Border

Other designs from this category

About Posters

Sold by

Paper Type: Standard Semi-Gloss

Your walls are a reflection of your personality, so let them speak with your favourite quotes, art, or designs printed on our custom Giclée posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom-sized posters and framing options to create art that’s a perfect representation of you.

  • Gallery-quality Giclée prints
  • Ideal for vibrant artwork and photographic reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-colour spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Medieval Chainmail Patent Blueprint Poster

Medieval Chainmail Patent Blueprint Poster

Vintage patent-style illustration of chainmail armour with knight figure and construction diagrams, emphasising rivets, texture, and medieval craftsmanship for a unique apparel motif.

Customer Reviews

4.7 out of 5 stars rating14.9K Total Reviews
12719 total 5-star reviews1378 total 4-star reviews273 total 3-star reviews163 total 2-star reviews337 total 1-star reviews
14,870 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jodi F.15 December 2025Verified Purchase
Print, Size: 91.44cm x 60.96cm, Media: Standard Semi-Gloss
it's very good quality especially for cutting out, i chose too big of a size but thats okay as it still looks really cute on my door :3 and so cheap to print as well thank you.
5.0 out of 5 stars rating
5 out of 5 stars rating
By A N.8 January 2022Verified Purchase
Print, Size: 50.80cm x 40.64cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
Zazzle's pictures are Amazing - I can't find these Products in the type of papers I need anywhere else. They cut them to the exact size you need , often changing the proportions to your exact requirement, The Customer Support are second to none , helpful, friendly and polite . Incredible Company - The prices are Great and so much to choose from. The Prints are clear and well Defined.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa26 January 2021Verified Purchase
Print, Size: 30.48cm x 30.48cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
Absolutely love my poster. I have it hung in my reiki treatment room. Had so many compliments about it. The pastel colours are truly amazing

Tags

Posters
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design
All Products
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design

Other Info

Product ID: 256234444112308138
Created on 08/01/2026, 21:59
Rating: G