Tap / click on image to see more RealViewsTM
£48.00
per poster
 

Medieval Chainmail Patent Blueprint Poster

Qty:
60.96 cm x 81.28 cm (24"x32")
None

Other designs from this category

About Posters

Sold by

Paper Type: Value (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favourite quotes, art, or designs printed on our custom Giclée posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom-sized posters and framing options to create art that’s a perfect representation of you.

  • Gallery-quality Giclée prints
  • Ideal for vibrant artwork and photographic reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-colour spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Medieval Chainmail Patent Blueprint Poster

Medieval Chainmail Patent Blueprint Poster

Vintage patent-style illustration of chainmail armour with knight figure and construction diagrams, emphasising rivets, texture, and medieval craftsmanship for a unique apparel motif.

Customer Reviews

4.8 out of 5 stars rating14.8K Total Reviews
12679 total 5-star reviews1376 total 4-star reviews270 total 3-star reviews160 total 2-star reviews325 total 1-star reviews
14,810 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.17 January 2013Verified Purchase
Print, Size: 58.42cm x 67.37cm, Media: Value (Semi-Gloss)
Zazzle Reviewer Program
I like the design features on the website. They enable the fitting of a good quality Print to an existing frame. This Print was of excellent quality. I would buy again. One small gripe is that the image was not centred horizontally (about 3mm out) so needed trimming. No great hardship and may have been my fault in the setting-up. Next time, I would choose to set the text below the picture to a smaller font. Overall - Thank You! Looks good in its frame - Just as expected. I had a very expensive Gallery print of this before. It got damaged - hence the replacement. It compares very well.
5.0 out of 5 stars rating
5 out of 5 stars rating
By A.26 April 2018Verified Purchase
Print, Size: 33.02cm x 48.26cm, Media: Value (Semi-Gloss)
Zazzle Reviewer Program
Would highly recommend as very helpful. Prints...just perfect 😀
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.26 January 2021Verified Purchase
Print, Size: 30.48cm x 30.48cm, Media: Value (Semi-Gloss)
Zazzle Reviewer Program
Absolutely love my poster. I have it hung in my reiki treatment room. Had so many compliments about it. The pastel colours are truly amazing

Tags

Posters
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design
All Products
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design

Other Info

Product ID: 256234444112308138
Created on 08/01/2026, 21:59
Rating: G