Sell on Zazzle
Tap / click on image to see more RealViewsTM
£13.40
per mug
 

Merry Christmas Classic Mug, 11 oz Coffee Mug

4.8 out of 5 stars rating
22239 Total Reviews |
by
Qty:
Personalise this template
Style
Classic Mug
+£1.10
+£2.20
+£5.55
+£11.15
Size

Other designs from this category

About Mugs

Sold by
Mug
Create your own from scratch

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Merry Christmas Classic Mug, 11 oz Coffee Mug

Merry Christmas Classic Mug, 11 oz Coffee Mug

Merry Christmas mug Welcome the warmth of Christmas with the Merry Christmas Mug, the perfect choice to accompany your special moments with your family and loved ones. Charming Christmas Design: Decorated with a typical Christmas illustration of a pine tree. High Quality Material: Made of premium heat-resistant ceramic, perfect for enjoying your favourite hot chocolate, tea or coffee in winter. Comfortable Size: ideal to accompany your relaxing time during the holiday season. Special Gift Choice: Perfect as a Christmas gift for friends, family or colleagues, bringing a warm atmosphere to their hearts. Easy to Care for: Safe for daily use. Bring the Christmas spirit into every sip with the Merry Christmas Mug. Order now and make your Christmas moments even more memorable!
GOODPOD
Artwork designed by
bekasi, west java, Indonesia
View their Store

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19645 total 5-star reviews1890 total 4-star reviews344 total 3-star reviews140 total 2-star reviews220 total 1-star reviews
22,239 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016 • Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020 • Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020 • Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
mugcupsmerrychristmaschristmasgiftdrinkware
All Products
mugcupsmerrychristmaschristmasgiftdrinkware

Other Info

Product ID: 256883768901623925
Created on 27/11/2024, 21:27
Rating: G